missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SUB1 (Human) Recombinant Protein

Human SUB1 partial ORF ( AAH09610.1, 32 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00010923-Q01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185862

  • 310.00 € / 10 Mikrogramm

Verfügbar ab
21-12-2020

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: APEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAV
Spezifikation

Spezifikation

AAH09610.1
SUB1 homolog (S. cerevisiae)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SUB1
GST
10923
Wheat germ expression system
10 μg
MGC102747, P15, PC4, p14
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation