missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRPL50 Antibody, R&D Systems™

MRPL50 Antibody, R&D Systems™

Artikelnummer. 18614387 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Quantity:
100 μg
25 μL
Packungsgröße:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity Packungsgröße
18614387 25 μL 25µL
18694538 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18614387 Lieferant Novus Biologicals Lieferanten-Nr. NBP26872825ul
  • ONLINE EXCLUSIVE PRICE
    457.09 €
    391.65 € / 25 Mikroliter
    Sparen 65.44 €
    14% Rabatt
 Restricted Item
Verfügbar ab: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MRPL50 Polyclonal specifically detects MRPL50 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen MRPL50
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias 39S ribosomal protein L50, mitochondrial, FLJ20493, L50mt, mitochondrial 39S ribosomal protein L50, mitochondrial ribosomal protein L50, MRP-L50FLJ21990
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54534
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.