missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. TIMP-1 Antibody, Novus Biologicals™

TIMP-1 Antibody, Novus Biologicals™

Artikelnummer. 18117118 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18117118 0.1 mL 0.10 Milliliter
18612996 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18117118 Lieferant Novus Biologicals Lieferanten-Nr. NBP238700

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

TIMP-1 Polyclonal specifically detects TIMP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen TIMP-1
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer P01033
Gen-Alias CLGI, Collagenase inhibitor, collagenase inhibitor), EPATIMP-1, EPO, erythroid potentiating activity, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, FLJ90373, HCI, metalloproteinase inhibitor 1, TIMP metallopeptidase inhibitor 1, TIMPtissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, Tissue inhibitor of metalloproteinases 1
Gensymbole TIMP1
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
Reinigungsverfahren Affinity Purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Angiogenesis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix
Primär oder sekundär Primary
Gen-ID (Entrez) 7076
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.