missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
TUT1 Polyclonal specifically detects TUT1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
Spezifikation
| Antigen | TUT1 |
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Zusammensetzung | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gen-Alias | EC 2.7.7.19, EC 2.7.7.52, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC149809, nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase, nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase, PAP-associated domain-containing 2, PAPD2, poly(A) polymerase associated domain containing 2, RBM21, RNA binding motif protein 21, RNA uridylyltransferase, RNA-binding motif protein 21, RNA-binding protein 21, speckle targeted PIP5K1A-regulated poly(A) polymerase, star-PAP, STARPAP, terminal uridylyl transferase 1, U6 snRNA-specific, TUTase, U6 snRNA-specific terminal uridylyltransferase 1, U6 TUTase, U6-TUTase |
| Gensymbole | TUT1 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?