missing translation for 'onlineSavingsMsg'
Learn More

U2AF1L4 Antibody, Novus Biologicals™

Artikelnummer. 18220724 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μL
25 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18220724 100 μL 100 Mikroliter
18629486 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18220724 Lieferant Novus Biologicals Lieferanten-Nr. NBP255898

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

U2AF1L4 Polyclonal specifically detects U2AF1L4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen U2AF1L4
Anwendungen Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gen-Alias FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA auxiliary factor 1-like protein 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 3, U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3, U2AF1L3, U2AF1L3V1, U2AF1-like protein 3, U2AF1RS3, U2AF1-RS3, U2af26
Gensymbole U2AF1L4
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
Reinigungsverfahren Affinity Purified
Menge 100 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 199746
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.