missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ WFDC2 Recombinant Protein
Human full-length ORF recombinant protein with GST-tag at N-terminal
335.00 € - 508.00 €
Spezifikation
| Zugriffsnummer | AAH46106.1 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-ID (Entrez) | 10406 |
| Molekulargewicht | 36.08 |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16185022
|
Abnova™
H00010406-P01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 05-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
|
16195022
|
Abnova™
H00010406-P01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 05-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Beschreibung
- Encoded by WAP four-disulfide core domain 2
- Molecular weight: 36.08kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in elution buffer
Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Best when used within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
| AAH46106.1 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 36.08 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| WFDC2 | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10406 | |
| WFDC2 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF | |
| HE4/MGC57529/WAP5/dJ461P17.6 | |
| WFDC2 | |
| Wheat Germ (in vitro) | |
| GST |