Learn More
Abnova™ WFDC2 Recombinant Protein
Human full-length ORF recombinant protein with GST-tag at N-terminal
Marke: Abnova™ H00010406-P01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
- Encoded by WAP four-disulfide core domain 2
- Molecular weight: 36.08kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in elution buffer
Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Best when used within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
AAH46106.1 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
36.08 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF | |
HE4/MGC57529/WAP5/dJ461P17.6 | |
WFDC2 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, ELISA, Protein Array, Western Blot | |
10406 | |
WFDC2 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
WFDC2 | |
Human | |
Recombinant | |
Solution |