missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
ADAMTS13 Polyclonal antibody specifically detects ADAMTS13 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
Spezifikation
| Antigen | ADAMTS13 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol |
| Gen-Alias | A disintegrin and metalloproteinase with thrombospondin motifs 13, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 13, ADAM metallopeptidase with thrombospondin type 1 motif, 13, ADAM-TS13, ADAMTS-13, DKFZp434C2322, EC 3.4.24.14, EC 3.4.24.82, EC 3.4.24.87, FLJ42993, MGC118899, MGC118900, TTPADAM-TS 13, vWF-cleaving protease, vWF-CPC9orf8, VWFCPvon Willebrand factor-cleaving protease |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV |
| Reinigungsverfahren | Immunogen affinity purified |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?