missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-05640-20ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Adenine Nucleotide Translocase 1/2/3/4 Polyclonal antibody specifically detects Adenine Nucleotide Translocase 1/2/3/4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| Adenine Nucleotide Translocase 1/2/3/4 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| 2F1, AAC1, AAC2, AAC3, AAC4, adenine nucleotide translocase 4, adenine nucleotide translocator 1 (skeletal muscle), adenine nucleotide translocator 2 (fibroblast), Adenine nucleotide translocator 3, Adenine nucleotide translocator 4, ADP,ATP carrier protein 1, ADP,ATP carrier protein 3, ADP,ATP carrier protein 4, ADP,ATP carrier protein, fibroblast isoform, ADP,ATP carrier protein, heart/skeletal muscle, ADP,ATP carrier protein, isoform T2, ADP,ATP carrier protein, liver, ADP/ATP translocase 1, ADP/ATP translocase 2, ADP/ATP translocase 3, ADP/ATP translocase 4, ADP/ATP translocator of liver, ANT, ANT 1, ANT 2, ANT 3, ANT 4, ANT1, ANT2, ANT3, ANT3Y, ANT4, epididymis secretory sperm binding protein, heart/skeletal muscle ATP/ADP translocator, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4, solute carr | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2). GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV | |
| 20 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 291 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur