missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Alkaline Phosphatase/ALPL Rabbit anti-Human, Mouse, Rat, Clone: 10B1M5, Novus Biologicals™
Beschreibung
Alkaline Phosphatase/ALPL Monoclonal antibody specifically detects Alkaline Phosphatase/ALPL in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
Spezifikation
| Antigen | Alkaline Phosphatase/ALPL |
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Monoclonal |
| Klon | 10B1M5 |
| Konjugat | Unconjugated |
| Verdünnung | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Zusammensetzung | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gen-Alias | Alkaline phosphatase liver/bone/kidney isozyme, alkaline phosphatase, liver/bone/kidney, alkaline phosphatase, tissue-nonspecific isozyme, alkaline phosphomonoesterase, APTNAP, AP-TNAP, EC 3.1.3.1, FLJ40094, FLJ93059, glycerophosphatase, HOPS, liver/bone/kidney-type alkaline phosphatase, MGC161443, tissue-nonspecific ALP, TNAP, TNSALPMGC167935 |
| Wirtsspezies | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alkaline Phosphatase/ALPL (ALPL) (P05186). MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKT |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?