missing translation for 'onlineSavingsMsg'
Learn More

acetylcholinesterase (Yt blood group), Mouse, Clone: 2C3, Abnova™

Artikelnummer. 16104274
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
Artikelnummer. Menge unitSize
16104274 100 μg 100 Mikrogramm
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16104274

Marke: Abnova H00000043M02.100ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Mouse monoclonal antibody raised against a partial recombinant ACHE.

Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. Acetylcholinesterase exists in multiple molecular forms which possess similar catalytic properties, but differ in their oligomeric assembly and mode of cell attachment to the cell surface. It is encoded by the single ACHE gene, and the structural diversity in the gene products arises from alternative mRNA splicing, and post-translational associations of catalytic and structural subunits. The major form of acetylcholinesterase found in brain, muscle and other tissues is the hydrophilic species, which forms disulfide-linked oligomers with collagenous, or lipid-containing structural subunits. The other, alternatively spliced form, expressed primarily in the erythroid tissues, differs at the C-terminal end, and contains a cleavable hydrophobic peptide with a GPI-anchor site. It associates with the membranes through the phosphoinositide (PI) moieties added post-translationally. [provided by RefSeq

Sequence: ARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL

Spezifikation

Antigen acetylcholinesterase (Yt blood group)
Anwendungen ELISA
Klassifikation Monoclonal
Klon 2C3
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a partial recombinant ACHE.
Zusammensetzung PBS with no preservative; pH 7.4
Gen ACHE
Gen-Zugriffsnummer NM_000665
Gen-Alias ARACHE/N-ACHE/YT
Gensymbole ACHE
Wirtsspezies Mouse
Immunogen ACHE (NP_000656, 515 a.a. ∼ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reinigungsverfahren Affinity Purified
Menge 100 μg
Regulatorischer Status RUO
Forschungsgebiet Cell Adhesion
Primär oder sekundär Primary
Gen-ID (Entrez) 43
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotype IgG2a κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.