CREB1, Mouse, Clone: 2B2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CREB1.

Marke: Abnova H00001385-M08.100ug

Artikelnummer. 16136634

349.00 € / 100 Mikrogramm

Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: DAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQ

Spezifikation

Antigen	CREB1
Klassifikation	Monoclonal
Konjugat	Unconjugated
Zusammensetzung	PBS with no preservative; pH 7.4
Gen-Zugriffsnummer	BC010636
Gensymbole	CREB1
Immunogen	CREB1 (AAH10636.1, 14 a.a. ∼ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Menge	100 μg
Primär oder sekundär	Primary
Zielspezies	Human
Produkttyp	Antibody
Isotype	IgG2a κ

Anwendungen	ELISA, Western Blot
Klon	2B2
Beschreibung	Mouse monoclonal antibody raised against a partial recombinant CREB1.
Gen	CREB1
Gen-Alias	CREB/MGC9284
Wirtsspezies	Mouse
Reinigungsverfahren	Affinity chromatography
Regulatorischer Status	RUO
Gen-ID (Entrez)	1385
Inhalt und Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

CREB1, Mouse, Clone: 2B2, Abnova™

Beschreibung

Spezifikation

Product Suggestions

Documents

Promotions