missing translation for 'onlineSavingsMsg'
Learn More

ETF1, Mouse, Clone: 2H4, Abnova™

Artikelnummer. 16107814
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
Artikelnummer. Menge unitSize
16107814 100 μg 100 Mikrogramm
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16107814

Marke: Abnova H00002107M02.100ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Mouse monoclonal antibody raised against a partial recombinant ETF1.

Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).[supplied by OMIM

Sequence: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY

Spezifikation

Antigen ETF1
Anwendungen ELISA, Western Blot
Klassifikation Monoclonal
Klon 2H4
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a partial recombinant ETF1.
Zusammensetzung PBS with no preservative; pH 7.4
Gen ETF1
Gen-Zugriffsnummer NM_004730
Gen-Alias D5S1995/ERF/ERF1/MGC111066/RF1/SUP45L1/TB3-1
Gensymbole ETF1
Wirtsspezies Mouse
Immunogen ETF1 (NP_004721.1, 338 a.a. ∼ 437 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reinigungsverfahren Affinity chromatography
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 2107
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Form Liquid
Isotype IgG2b κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.