missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16199688

malonyl CoA:ACP acyltransferase (mitochondrial), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Artikelnummer. 16199688
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
Artikelnummer. Menge unitSize
16199688 100 μg 100 Mikrogramm
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16199688

Marke: Abnova H00027349D01P.100ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit polyclonal antibody raised against a full-length human MCAT protein.

The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL

Spezifikation

Antigen malonyl CoA:ACP acyltransferase (mitochondrial)
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Beschreibung Rabbit polyclonal antibody raised against a full-length human MCAT protein.
Zusammensetzung PBS with no preservative; pH 7.4
Gen MCAT
Gen-Zugriffsnummer NM_014507.2
Gen-Alias FASN2C/MCT/MGC47838/MT/fabD
Gensymbole MCAT
Wirtsspezies Rabbit
Immunogen MCAT (NP_055322.1, 1 a.a. ∼ 180 a.a) full-length human protein.
Reinigungsverfahren Affinity Purified
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 27349
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.