missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16190278

v-mos Moloney murine sarcoma viral oncogene homolog, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16190278
Change view
Click to view available options
Menge:
50 μL
Packungsgröße:
50 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16190278 50 μL 50 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16190278 Lieferant Abnova Lieferanten-Nr. H00004342B01.50uL

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse polyclonal antibody raised against a full-length human MOS protein.

MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM

Sequence: MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG

Spezifikation

Antigen v-mos Moloney murine sarcoma viral oncogene homolog
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Beschreibung Mouse polyclonal antibody raised against a full-length human MOS protein.
Zusammensetzung No additive
Gen MOS
Gen-Zugriffsnummer NM_005372.1
Gen-Alias MGC119962/MGC119963/MSV
Gensymbole MOS
Wirtsspezies Mouse
Immunogen MOS (NP_005363.1, 1 a.a. ∼ 346 a.a) full-length human protein.
Menge 50 μL
Regulatorischer Status RUO
Forschungsgebiet Cell Cycle
Ganzes Molekül Yes
Primär oder sekundär Primary
Gen-ID (Entrez) 4342
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.