p21 protein (Cdc42/Rac)-activated kinase 1, Mouse, Clone: 1E11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PAK1.

Marke: Abnova H00005058-M01.100ug

Artikelnummer. 16192345

349.00 € / 100 Mikrogramm

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

PAK proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. These proteins serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK1 regulates cell motility and morphology. Alternativelt spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA

Spezifikation

Antigen	p21 protein (Cdc42/Rac)-activated kinase 1
Klassifikation	Monoclonal
Konjugat	Unconjugated
Zusammensetzung	PBS with no preservative; pH 7.4
Gen-Zugriffsnummer	NM_002576
Gensymbole	PAK1
Immunogen	PAK1 (NP_002567, 191 a.a. ∼ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Menge	100 μg
Forschungsgebiet	Apoptosis
Gen-ID (Entrez)	5058
Inhalt und Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG1 κ

Anwendungen	ELISA, Immunohistochemistry (PFA fixed), Western Blot
Klon	1E11
Beschreibung	Mouse monoclonal antibody raised against a partial recombinant PAK1.
Gen	PAK1
Gen-Alias	MGC130000/MGC130001/PAKalpha
Wirtsspezies	Mouse
Reinigungsverfahren	Affinity Purified
Regulatorischer Status	RUO
Primär oder sekundär	Primary
Zielspezies	Human
Produkttyp	Antibody

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

p21 protein (Cdc42/Rac)-activated kinase 1, Mouse, Clone: 1E11, Abnova™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen