missing translation for 'onlineSavingsMsg'
Learn More

regulator of G-protein signaling 5, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16178625
Change view
Click to view available options
Menge:
50 μL
Conditionnement:
50 Mikroliter
Code produit. Menge unitSize
16178625 50 μL 50 Mikroliter
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16178625

Marque: Abnova H00008490A01

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel ist im Moment nicht verfügbar oder wird nicht mehr hergestellt.
Schauen Sie bitte auf unsere Produktseite nach möglichen Alternativen
Voir les produits de remplacement

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Mouse polyclonal antibody raised against a partial recombinant RGS5.

The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM

Sequence: WIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Spécification

Antigen regulator of G-protein signaling 5
Anwendungen ELISA, Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Beschreibung Mouse polyclonal antibody raised against a partial recombinant RGS5.
Zusammensetzung 50% glycerol
Gen RGS5
Gen-Zugriffsnummer NM_003617
Gen-Alias MST092/MST106/MST129/MSTP032/MSTP092/MSTP106/MSTP129
Gensymbole RGS5
Wirtsspezies Mouse
Immunogen RGS5 (NM_003617, 94 a.a. ∼ 181 a.a) partial recombinant protein with GST tag.
Menge 50 μL
Regulatorischer Status RUO
Forschungsgebiet Signal Transduction
Ganzes Molekül Yes
Primär oder sekundär Primary
Gen-ID (Entrez) 8490
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.