missing translation for 'onlineSavingsMsg'
Learn More

transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A), Mouse, Clone: 1F3, Abnova™

Artikelnummer. 16116345
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
Artikelnummer. Menge unitSize
16116345 100 μg 100 Mikrogramm
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16116345

Marke: Abnova H00006924M02.100ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Mouse monoclonal antibody raised against a partial recombinant TCEB3.

This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. [provided by RefSeq

Sequence: NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY

Spezifikation

Antigen transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
Anwendungen ELISA, Immunofluorescence, Western Blot
Klassifikation Monoclonal
Klon 1F3
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a partial recombinant TCEB3.
Zusammensetzung PBS with no preservative; pH 7.4
Gen TCEB3
Gen-Zugriffsnummer NM_003198
Gen-Alias FLJ38760/FLJ42849/SIII/TCEB3A
Gensymbole TCEB3
Wirtsspezies Mouse
Immunogen TCEB3 (NP_003189, 81 a.a. ∼ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reinigungsverfahren Affinity Purified
Menge 100 μg
Regulatorischer Status RUO
Forschungsgebiet Transcription Regulation
Ganzes Molekül Yes
Primär oder sekundär Primary
Gen-ID (Entrez) 6924
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotype IgG2a κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.