missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Arrestin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 €
Spezifikation
| Antigen | Arrestin 3 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18295001
|
Novus Biologicals
NBP1-69084 |
100 μL |
483.00 €
100 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
Arrestin 3 Polyclonal specifically detects Arrestin 3 in Human samples. It is validated for Western Blot.Spezifikation
| Arrestin 3 | |
| Polyclonal | |
| Rabbit | |
| Cell Biology, Cellular Markers, GPCR, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Virology Bacteria and Parasites, Vision | |
| arrestin 3, retinal (X-arrestin), arrestin 4, arrestin-C, ARRXcArr, CAR, C-arrestin, Cone arrestin, Retinal cone arrestin-3, X-arrestin | |
| ARR3 | |
| IgG | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| 407 | |
| Synthetic peptides corresponding to ARR3 (arrestin 3, retinal (X-arrestin)) The peptide sequence was selected from the C terminal of ARR3. Peptide sequence DVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS. | |
| Primary |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts