missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18614497

ARSJ Antibody, R&D Systems™

Artikelnummer. 18614497 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0.1 mL
Packungsgröße:
0.10 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18614497 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18614497 Lieferant Novus Biologicals Lieferanten-Nr. NBP248658
  • ONLINE EXCLUSIVE PRICE
    626.08 €
    540.75 € / 0.1 Milliliter
    Sparen 85.33 €
    13% Rabatt
 Eingeschränkter Artikel
Verfügbar ab: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ARSJ Polyclonal antibody specifically detects ARSJ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ARSJ
Anwendungen Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias arylsulfatase family, member J, arylsulfatase J, ASJ, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.12, FLJ23548
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Reinigungsverfahren Immunogen affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Lipid and Metabolism
Primär oder sekundär Primary
Gen-ID (Entrez) 79642
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.