missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4), Novus Biologicals™
Mouse Monoclonal Antibody
Marke: Novus Biologicals™ H00027163-M02
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Monoclonal antibody specifically detects ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase in Human samples. It is validated for ELISA,Immunoprecipitation,Western Blot
Spezifikation
| ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase | |
| Monoclonal | |
| Unconjugated | |
| NP_055250 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 27163 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles. | |
| IgG2a κ |
| ELISA, Immunoprecipitation, Western Blot | |
| 3F4 | |
| In 1x PBS, pH 7.4 | |
| Acid ceramidase-like protein, ASAHL, ASAH-like protein, EC 3.5.1.-, N-acylethanolamine acid amidase, N-acylethanolamine-hydrolyzing acid amidase, N-acylsphingosine amidohydrolase (acid ceramidase)-like, N-acylsphingosine amidohydrolase-like, PLT | |
| NAAA (NP_055250, 36 a.a. ∽ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur