missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4), Novus Biologicals™

Artikelnummer. 18345969 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mg
Packungsgröße:
0.01 Milligramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18345969 0.1 mg 0.01 Milligramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18345969 Lieferant Novus Biologicals™ Lieferanten-Nr. H00027163M02

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Mouse Monoclonal Antibody

ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Monoclonal antibody specifically detects ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase in Human samples. It is validated for ELISA,Immunoprecipitation,Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase
Anwendungen ELISA, Immunoprecipitation, Western Blot
Klassifikation Monoclonal
Klon 3F4
Konjugat Unconjugated
Zusammensetzung In 1x PBS, pH 7.4
Gen-Zugriffsnummer NP_055250
Gen-Alias Acid ceramidase-like protein, ASAHL, ASAH-like protein, EC 3.5.1.-, N-acylethanolamine acid amidase, N-acylethanolamine-hydrolyzing acid amidase, N-acylsphingosine amidohydrolase (acid ceramidase)-like, N-acylsphingosine amidohydrolase-like, PLT
Wirtsspezies Mouse
Immunogen NAAA (NP_055250, 36 a.a. ∽ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD
Reinigungsverfahren IgG purified
Menge 0.1 mg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 27163
Zielspezies Human
Inhalt und Lagerung Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.