missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4), Novus Biologicals™
Alle ansehen Bio Techne ProdukteBeschreibung
ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Monoclonal antibody specifically detects ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase in Human samples. It is validated for ELISA,Immunoprecipitation,Western Blot
Spezifikation
Spezifikation
| Antigen | ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase |
| Anwendungen | ELISA, Immunoprecipitation, Western Blot |
| Klassifikation | Monoclonal |
| Klon | 3F4 |
| Konjugat | Unconjugated |
| Zusammensetzung | In 1x PBS, pH 7.4 |
| Gen-Zugriffsnummer | NP_055250 |
| Gen-Alias | Acid ceramidase-like protein, ASAHL, ASAH-like protein, EC 3.5.1.-, N-acylethanolamine acid amidase, N-acylethanolamine-hydrolyzing acid amidase, N-acylsphingosine amidohydrolase (acid ceramidase)-like, N-acylsphingosine amidohydrolase-like, PLT |
| Wirtsspezies | Mouse |
| Immunogen | NAAA (NP_055250, 36 a.a. ∽ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?