missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Atrial Natriuretic Peptide/ANP Antibody, Novus Biologicals™

Atrial Natriuretic Peptide/ANP Antibody, Novus Biologicals™

Artikelnummer. 30231445 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
20 μL
100 μL
Packungsgröße:
100 Mikroliter
20 Mikroliter
Artikelnummer. Menge unitSize
30231445 20 μL 20 Mikroliter
30232755 100 μL 100 Mikroliter
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30231445

Marke: Novus Biologicals NBP33332520ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Monoclonal Antibody

Atrial Natriuretic Peptide/ANP Monoclonal antibody specifically detects Atrial Natriuretic Peptide/ANP in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Atrial Natriuretic Peptide/ANP
Anwendungen ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Monoclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:2000 - 1:6000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Zusammensetzung PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gen-Alias ANF, ANPatriopeptin, ATFB6, atrial natriuretic factor, Atrial natriuretic peptide, CDD-ANF, natriuretic peptide A, natriuretic peptide precursor A, PNDcardionatrin, prepronatriodilatin
Wirtsspezies Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atrial Natriuretic Peptide/ANP (NP_006163.1).,, Sequence:, MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG
Reinigungsverfahren Affinity purified
Menge 20 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 4878
Zielspezies Human, Mouse
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.