missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BBS4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
409.50 € - 540.75 €
Spezifikation
| Antigen | BBS4 |
|---|---|
| Verdünnung | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18492411
|
Novus Biologicals
NBP1-86248-25ul |
25 μL |
 433.00 € 409.50 € / 25 Mikroliter Sparen 23.50 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18274167
|
Novus Biologicals
NBP1-86248 |
0.1 mL |
572.00 € 540.75 € / 0.10 Milliliter Sparen 31.25 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
BBS4 Polyclonal specifically detects BBS4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| BBS4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Bardet-Biedl syndrome 4, Bardet-Biedl syndrome 4 protein | |
| BBS4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers, Vision | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 585 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts