missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BBS5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-55191
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
BBS5 Polyclonal specifically detects BBS5 in Human samples. It is validated for Western Blot.
Spezifikation
| BBS5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Bardet-Biedl syndrome 5, Bardet-Biedl syndrome 5 protein, DKFZp762I194 | |
| Rabbit | |
| 39 kDa | |
| 100 μL | |
| Vision | |
| 129880 | |
| Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8N3I7 | |
| BBS5 | |
| Synthetic peptides corresponding to BBS5(Bardet-Biedl syndrome 5) The peptide sequence was selected from the middle region of BBS5. Peptide sequence VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur