missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. BET1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

BET1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18341876 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
18341876 100 μg 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18341876

Marke: Novus Biologicals NBP310821100UL

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

BET1 Polyclonal specifically detects BET1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen BET1
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1.0 ug/ml
Zusammensetzung PBS buffer, 2% sucrose
Gen-Alias Bet1 (S. cerevisiae) homolog, BET1 homolog, BET1 homolog (S. cerevisiae), Bet1p homolog, blocked early in transport 1 homolog (S. cerevisiae), DKFZp781C0425, Golgi vesicular membrane trafficking protein p18, Golgi vesicular membrane-trafficking protein p18, HBET1
Wirtsspezies Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human BET1 (NP_005859.1). Peptide sequence IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM
Reinigungsverfahren Affinity purified
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 10282
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.