missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BET1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
461.00 €
Spezifikation
| Antigen | BET1 |
|---|---|
| Verdünnung | Western Blot 1.0 ug/ml |
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18341876
|
Novus Biologicals
NBP3-10821-100UL |
100 μg |
461.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
BET1 Polyclonal specifically detects BET1 in Human samples. It is validated for Western Blot.Spezifikation
| BET1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Bet1 (S. cerevisiae) homolog, BET1 homolog, BET1 homolog (S. cerevisiae), Bet1p homolog, blocked early in transport 1 homolog (S. cerevisiae), DKFZp781C0425, Golgi vesicular membrane trafficking protein p18, Golgi vesicular membrane-trafficking protein p18, HBET1 | |
| The immunogen is a synthetic peptide directed towards the middle terminal region of human BET1 (NP_005859.1). Peptide sequence IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 10282 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts