missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. C1D Antibody, Novus Biologicals™

C1D Antibody, Novus Biologicals™

Artikelnummer. 18280176 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25ul
Unit Size:
0.10 Milliliter
25 Mikroliter
Product Code. Menge unitSize
18280176 0.1 mL 0.10 Milliliter
18420391 25ul 25 Mikroliter
2 options
This item is not returnable. View return policy

Product Code. 18280176

Brand: Novus Biologicals NBP181287

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

C1D Polyclonal specifically detects C1D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen C1D
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias C1D DNA-binding protein, C1D nuclear receptor corepressor, C1D nuclear receptor co-repressor, hC1D, MGC12261, MGC14659, nuclear DNA-binding protein, nuclear nucleic acid-binding protein C1D, small unique nuclear receptor corepressor, small unique nuclear receptor co-repressor, SUN-CoR, SUNCORLRP1
Gensymbole C1D
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
Reinigungsverfahren Affinity Purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet DNA replication Transcription Translation and Splicing
Primär oder sekundär Primary
Gen-ID (Entrez) 10438
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.