missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18374340

Novus Biologicals™ Cadherin-17 Recombinant Protein Antigen

Artikelnummer. 18374340 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0,1 mL
Packungsgröße:
0.10 Milliliter
Artikelnummer. Menge unitSize
18374340 0,1 mL 0.10 Milliliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18374340

Marke: Novus Biologicals™ NBP188239PEP

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH17. The Cadherin-17 Recombinant Protein Antigen is derived from E. coli. The Cadherin-17 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-88239. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 1015
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gensymbol CDH17
Markertyp Unmarkiert
Molekulargewicht 27kDa
Produkttyp Cadherin-17
Menge 0,1 mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88239. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
Mehr anzeigen Weniger anzeigen

Nur für Forschungszwecke

Name des Produkts
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.