missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calreticulin-2/CALR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-33390-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Calreticulin-2/CALR3 Polyclonal specifically detects Calreticulin-2/CALR3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| Calreticulin-2/CALR3 | |
| Polyclonal | |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q96L12 | |
| CALR3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRN | |
| 25 μL | |
| Cancer | |
| 125972 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| calreticulin 2, calreticulin 3, Calreticulin-2, calreticulin-3, cancer/testis antigen 93, CRT2calreticulin-2, CT93, FLJ25355, MGC26577 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?
For Research Use Only