missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calsequestrin 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65 € - 590.10 €
Spezifikation
| Antigen | Calsequestrin 2 |
|---|---|
| Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18494572
|
Novus Biologicals
NBP2-33747-25ul |
25 μL |
415.00 € 391.65 € / 25 Mikroliter Sparen 23.35 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18170554
|
Novus Biologicals
NBP2-33747 |
0.1 mL |
624.00 € 590.10 € / 0.10 Milliliter Sparen 33.90 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
Calsequestrin 2 Polyclonal specifically detects Calsequestrin 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| Calsequestrin 2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O14958 | |
| 845 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Cardiovascular Biology, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| calsequestrin 2 (cardiac muscle), calsequestrin 2, fast-twitch, cardiac muscle, Calsequestrin, cardiac muscle isoform, calsequestrin-2, FLJ26321, FLJ93514, PDIB2 | |
| CASQ2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts