missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
Carbonic Anhydrase VIII/CA8 Polyclonal specifically detects Carbonic Anhydrase VIII/CA8 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
Spezifikation
| Antigen | Carbonic Anhydrase VIII/CA8 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gen-Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
| Gensymbole | CA8 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?