missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDS2 Antibody (2B9), Novus Biologicals™
Mouse Monoclonal Antibody
Marke: Novus Biologicals H00008760-M01
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CDS2 Monoclonal antibody specifically detects CDS2 in Human samples. It is validated for Western Blot, ELISA
Spezifikation
| CDS2 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| CDP-DAG synthase 2, CDP-DG synthase 2, CDP-DG synthetase 2, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, CDP-diacylglycerol synthase 2, CDP-diglyceride diphosphorylase 2, CDP-diglyceride pyrophosphorylase 2, CDP-diglyceride synthase 2, CDP-diglyceride synthetase 2, CDS 2, CTP:phosphatidate cytidylyltransferase 2, EC 2.7.7, EC 2.7.7.41, FLJ38111, phosphatidate cytidylyltransferase 2 | |
| CDS2 (NP_003809, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK | |
| 0.1 mg | |
| Endocrinology, Signal Transduction | |
| 8760 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA | |
| 2B9 | |
| Western Blot, ELISA | |
| NP_003809 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur