missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
CDS2 Polyclonal specifically detects CDS2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
Spezifikation
| Antigen | CDS2 |
| Anwendungen | Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gen-Alias | CDP-DAG synthase 2, CDP-DG synthase 2, CDP-DG synthetase 2, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, CDP-diacylglycerol synthase 2, CDP-diglyceride diphosphorylase 2, CDP-diglyceride pyrophosphorylase 2, CDP-diglyceride synthase 2, CDP-diglyceride synthetase 2, CDS 2, CTP:phosphatidate cytidylyltransferase 2, EC 2.7.7, EC 2.7.7.41, FLJ38111, phosphatidate cytidylyltransferase 2 |
| Gensymbole | CDS2 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?