missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. CDS2 Antibody, Novus Biologicals™

CDS2 Antibody, Novus Biologicals™

Artikelnummer. 18279697 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
Artikelnummer. Menge unitSize
18279697 0.1 mL 0.10 Milliliter
18491931 25 μL 25 Mikroliter
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18279697

Marke: Novus Biologicals NBP186435

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

CDS2 Polyclonal specifically detects CDS2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen CDS2
Anwendungen Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias CDP-DAG synthase 2, CDP-DG synthase 2, CDP-DG synthetase 2, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, CDP-diacylglycerol synthase 2, CDP-diglyceride diphosphorylase 2, CDP-diglyceride pyrophosphorylase 2, CDP-diglyceride synthase 2, CDP-diglyceride synthetase 2, CDS 2, CTP:phosphatidate cytidylyltransferase 2, EC 2.7.7, EC 2.7.7.41, FLJ38111, phosphatidate cytidylyltransferase 2
Gensymbole CDS2
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Reinigungsverfahren Affinity Purified
Menge 0.1 mL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 8760
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.