missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Chromogranin B Recombinant Protein Antigen
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
0.1mL
Packungsgröße:
0.10 Milliliter
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHGB. Source: E.coli Amino Acid Sequence: SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESE The Chromogranin B Recombinant Protein Antigen is derived from E. coli. The Chromogranin B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-80781. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Spezifikation
Spezifikation
| Gene ID (Entrez) | 1114 |
| Spezies | Human |
| Reinigungsverfahren | Chromatography |
| Reinheit | >80% |
| Konzentration | 0.5mg/mL |
| Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS and 1M Urea, pH 7.4. |
| Zur Verwendung mit (Anwendung) | Blocking/Neutralizing, Control |
| Gensymbol | CHGB |
| Markertyp | Unmarkiert |
| Mehr anzeigen |
Nur für Forschungszwecke
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur