missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
CRISP-1 Polyclonal antibody specifically detects CRISP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
Spezifikation
| Antigen | CRISP-1 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol |
| Gen-Alias | Acidic epididymal glycoprotein homolog, acidic epididymal glycoprotein-like 1, AEG-related protein, ARPAEG-like protein, CRISP-1AEGL1HSCRISP1D, cysteine-rich secretory protein 1, cysteine-rich secretory protein-1 delta, HSCRISP1G, HUMARP |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY |
| Reinigungsverfahren | Protein A purified |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?