missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRISP-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-62601
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CRISP-1 Polyclonal antibody specifically detects CRISP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| CRISP-1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Acidic epididymal glycoprotein homolog, acidic epididymal glycoprotein-like 1, AEG-related protein, ARPAEG-like protein, CRISP-1AEGL1HSCRISP1D, cysteine-rich secretory protein 1, cysteine-rich secretory protein-1 delta, HSCRISP1G, HUMARP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 167 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur