missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRISP-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65 € - 540.75 €
Spezifikation
| Antigen | CRISP-1 |
|---|---|
| Verdünnung | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18678366
|
Novus Biologicals
NBP2-62601-25ul |
25 μL |
 415.00 € 391.65 € / 25 Mikroliter Sparen 23.35 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18647148
|
Novus Biologicals
NBP2-62601 |
100 μg |
572.00 € 540.75 € / 100 Mikroliter Sparen 31.25 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
CRISP-1 Polyclonal antibody specifically detects CRISP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| CRISP-1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Acidic epididymal glycoprotein homolog, acidic epididymal glycoprotein-like 1, AEG-related protein, ARPAEG-like protein, CRISP-1AEGL1HSCRISP1D, cysteine-rich secretory protein 1, cysteine-rich secretory protein-1 delta, HSCRISP1G, HUMARP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 167 | |
| IgG | |
| Protein A purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts