missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18301440

Novus Biologicals™ CROT Recombinant Protein Antigen

Produktkod. 18301440 Handla allt< titel> Produkter
missing translation for 'orderingAttributeHoverText'
Menge:
0,1 mL
Förpackningsstorlek
0.10 Milliliter
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 18301440

missing translation for 'mfr': Novus Biologicals™ NBP185503PEP

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CROT. The CROT Recombinant Protein Antigen is derived from E. coli. The CROT Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-85503. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifikationer

Gene ID (Entrez) 54677
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gensymbol CROT
Markertyp Unmarkiert
Molekulargewicht 33kDa
Produkttyp CROT
Menge 0,1 mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85503. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen LAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWH
Visa mer Visa mindre

Nur für Forschungszwecke

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.