missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18155869

Novus Biologicals™ CSE1L/CAS/Exportin-2 Recombinant Protein Antigen

Artikelnummer. 18155869 Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
0,1 mL
Packungsgröße:
0.10 Milliliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18155869

Marke: Novus Biologicals™ NBP238384PEP

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CSE1L. The CSE1L/CAS/Exportin-2 Recombinant Protein Antigen is derived from E. coli. The CSE1L/CAS/Exportin-2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38384. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 1434
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gensymbol CSE1L
Markertyp Unmarkiert
Molekulargewicht 28kDa
Produkttyp CSE1L/CAS/Exportin-2
Menge 0,1 mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38384. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen HGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLF
Mostrar más Mostrar menos

Nur für Forschungszwecke

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado