missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CT45A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-46702-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CT45A1 Polyclonal antibody specifically detects CT45A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Spezifikation
| CT45A1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q8N7B7 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 541466 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Cancer/testis antigen 45-1, Cancer/testis antigen 45A1, cancer/testis antigen CT45-1, cancer/testis antigen family 45 member A1, cancer/testis antigen family 45, member A1, CT45, CT45.1, CT45-1XX-FW88277B6.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur