missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclin E1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 456.00 €
Spezifikation
| Antigen | Cyclin E1 |
|---|---|
| Verdünnung | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Anwendungen | Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18474941
|
Novus Biologicals
NBP1-88153 |
0.1 mL |
456.00 €
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18485541
|
Novus Biologicals
NBP1-88153-25ul |
25 μL |
302.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Cyclin E1 Polyclonal antibody specifically detects Cyclin E1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Spezifikation
| Cyclin E1 | |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Ovarian Carcinoma Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 898 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CCNEcyclin Es, cyclin E1, cyclin Et, G1/S-specific cyclin-E1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts