missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCAF12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
488.00 €
Spezifikation
| Antigen | DCAF12 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18255213
|
Novus Biologicals
NBP1-56584 |
100 μL |
488.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
DCAF12 Polyclonal specifically detects DCAF12 in Human samples. It is validated for Western Blot.Spezifikation
| DCAF12 | |
| Polyclonal | |
| Rabbit | |
| Q5T6F0 | |
| 25853 | |
| Synthetic peptides corresponding to WDR40A(WD repeat domain 40A) The peptide sequence was selected from the middle region of WDR40A. Peptide sequence TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DDB1- and CUL4-associated factor 12, CT102, DDB1 and CUL4 associated factor 12, KIAA1892, TCC52, WDR40A | |
| DCAF12 | |
| IgG |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts