missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00 € - 539.00 €
Spezifikation
| Antigen | DDR2 |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18247534
|
Novus Biologicals
NBP2-56485 |
100 μL |
539.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18661027
|
Novus Biologicals
NBP2-56485-25ul |
25 μL |
359.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
DDR2 Polyclonal specifically detects DDR2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| DDR2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CD167 antigen-like family member B, CD167b antigen, Discoidin domain receptor 2, discoidin domain receptor family, member 2, discoidin domain receptor tyrosine kinase 2, discoidin domain-containing receptor 2, EC 2.7.10, EC 2.7.10.1, hydroxyaryl-protein kinase, migration-inducing gene 16 protein, neurotrophic tyrosine kinase receptor related 3, Neurotrophic tyrosine kinase, receptor-related 3, NTRKR3cell migration-inducing protein 20, Receptor protein-tyrosine kinase TKT, TKTMIG20a, TYRO10, Tyrosine-protein kinase TYRO10, tyrosylprotein kinase | |
| DDR2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4921 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts