missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Bio-Techne NBP3-17013-100UL
Artikelnummer. 18329271
-
741.00 €
700.35 € / 100 Mikroliter
Sparen 40.65 €
5% Rabatt
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Polyclonal antibody specifically detects Dimethylarginine Dimethylaminohydrolase 1/DDAH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| Dimethylarginine Dimethylaminohydrolase 1/DDAH1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| DDAH-1, DDAHdimethylargininase-1, DDAHI, Dimethylargininase-1, dimethylarginine dimethylaminohydrolase 1FLJ25539, EC 3.5.3.18, FLJ21264, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1, NG, NG-dimethylarginine dimethylaminohydrolase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKE | |
| 100 μg | |
| Signal Transduction | |
| 23576 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur