missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit anti-Human, Rat, Clone: 1Q5F6, Novus Biologicals™
Rabbit Monoclonal Antibody
190.00 € - 496.00 €
Spezifikation
| Antigen | Dimethylarginine Dimethylaminohydrolase 1/DDAH1 |
|---|---|
| Klon | 1Q5F6 |
| Verdünnung | Western Blot 1:500 - 1:2000 |
| Anwendungen | Western Blot |
| Klassifikation | Monoclonal |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18396796
|
Novus Biologicals
NBP3-16444-20UL |
20 μg |
190.00 €
20 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18326144
|
Novus Biologicals
NBP3-16444-100UL |
100 μg |
496.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Monoclonal antibody specifically detects Dimethylarginine Dimethylaminohydrolase 1/DDAH1 in Human, Rat samples. It is validated for Western BlotSpezifikation
| Dimethylarginine Dimethylaminohydrolase 1/DDAH1 | |
| Western Blot 1:500 - 1:2000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| DDAH-1, DDAHdimethylargininase-1, DDAHI, Dimethylargininase-1, dimethylarginine dimethylaminohydrolase 1FLJ25539, EC 3.5.3.18, FLJ21264, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1, NG, NG-dimethylarginine dimethylaminohydrolase | |
| A synthetic peptide corresponding to a sequence within amino acids 186-285 of human Dimethylarginine Dimethylaminohydrolase 1/DDAH1 (O94760). IAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 1Q5F6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 23576 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts