missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA polymerase mu Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Spezifikation
| Antigen | DNA polymerase mu |
|---|---|
| Anwendungen | Western Blot, Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18221045
|
Novus Biologicals
NBP2-57664 |
100 μL |
624.00 €
100 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18608366
|
Novus Biologicals
NBP2-57664-25ul |
25 μL |
415.00 €
25 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
DNA polymerase mu Polyclonal specifically detects DNA polymerase mu in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Spezifikation
| DNA polymerase mu | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| DNA polymerase mu, DNA-directed DNA/RNA polymerase mu, EC 2.7.7.7, FLJ35482, Pol iota, Pol Mu, polmu, polymerase (DNA directed), mu, polymerase (DNA-directed), mu, Tdt-N, Terminal transferase | |
| POLM | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 27434 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts