missing translation for 'onlineSavingsMsg'
Learn More
Learn More
dynein, cytoplasmic 2, light intermediate chain 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 605.00 €
Spezifikation
| Antigen | dynein, cytoplasmic 2, light intermediate chain 1 |
|---|---|
| Anwendungen | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18653036
|
Novus Biologicals
NBP2-38008-25ul |
25 μL |
415.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18085666
|
Novus Biologicals
NBP2-38008 |
0.1 mL |
605.00 €
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
dynein, cytoplasmic 2, light intermediate chain 1 Polyclonal specifically detects dynein, cytoplasmic 2, light intermediate chain 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| dynein, cytoplasmic 2, light intermediate chain 1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8TCX1 | |
| 51626 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CGI-60, cytoplasmic dynein 2 light intermediate chain 1, D2LICDKFZp564A033, DKFZP564A033, dynein, cytoplasmic 2, light intermediate chain 1, LIC3Dynein 2 light intermediate chain | |
| DYNC2LI1 | |
| IgG | |
| Affinity Purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts