missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EED Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 559.00 €
Spezifikation
| Antigen | EED |
|---|---|
| Anwendungen | Western Blot, Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18207124
|
Novus Biologicals
NBP2-57195 |
100 μL |
559.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18626657
|
Novus Biologicals
NBP2-57195-25ul |
25 μL |
369.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
EED Polyclonal specifically detects EED in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Spezifikation
| EED | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8726 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| embryonic ectoderm development, HEED, polycomb protein EED, WAIT1, WAIT-1, WD protein associating with integrin cytoplasmic tails 1 | |
| EED | |
| IgG | |
| Affinity Purified |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts