missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Enteropeptidase/Enterokinase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65 € - 556.50 €
Spezifikation
| Antigen | Enteropeptidase/Enterokinase |
|---|---|
| Verdünnung | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18676046
|
Novus Biologicals
NBP2-62679-25ul |
25 μL |
415.00 € 391.65 € / 25 Mikroliter Sparen 23.35 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18628728
|
Novus Biologicals
NBP2-62679 |
100 μg |
589.00 € 556.50 € / 100 Mikroliter Sparen 32.50 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
Enteropeptidase/Enterokinase Polyclonal antibody specifically detects Enteropeptidase/Enterokinase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| Enteropeptidase/Enterokinase | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Epitope Tags, Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5651 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.4.21, EC 3.4.21.9, Enterokinase, ENTKenterokinase, MGC133046, protease, serine, 7 (enterokinase), PRSS7enteropeptidase, Serine protease 7, Transmembrane protease serine 15, transmembrane protease, serine 15 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title